PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn182921
Common NameDOF2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 437aa    MW: 47569 Da    PI: 7.9206
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn182921genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.3e-38122181261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC st+tkfCy+nny+++qPryfCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Achn182921 122 PDKILPCPRCSSTETKFCYFNNYNVNQPRYFCKNCQRYWTAGGSMRNVPVGSGRRKHKSS 181
                 7899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-27120179IPR003851Zinc finger, Dof-type
PfamPF027013.2E-31124180IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.286126180IPR003851Zinc finger, Dof-type
PROSITE patternPS013610128164IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MSLLRDPAIK LFGKTISVQP NKEASSFTAT IPPPHVAAAA ADLNLVSSTT SSSSSSHGDL  60
ICISVDDQED NQKPSEYVKY LEISSGYPKT PSVNNEPTSP KVSKNDEQSE TSITQETTPK  120
KPDKILPCPR CSSTETKFCY FNNYNVNQPR YFCKNCQRYW TAGGSMRNVP VGSGRRKHKS  180
SPASHYGHIM VSESLHNGNA TVLAFGSDLP LCESIASALS LAEESRNCFQ KQKVSVSCGD  240
DNSSRSSVTV SNSTDHQRGD SALQETVVTN FQTLAPQVQC FAGPPWACPP GFSPSAFPVT  300
FYPAPAYWGC TLPGPYWGTC TSPEPALCSS PNSQNLGKHS RDGDMIRPSN SEKDSERSRV  360
WIPKTLRIDD PSEAAKSSIW STLGIKNEKH NSTNGRSMFK AFESKVDEKN HRSERPLVLQ  420
ANPAALARSL NFHECV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX0675340.0JX067534.1 Actinidia chinensis clone 324501 Dof zinc finger protein (DOF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895107.11e-141PREDICTED: cyclic dof factor 1
TrEMBLS4SKB20.0S4SKB2_ACTCH; Dof zinc finger protein
STRINGVIT_14s0108g00980.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-74cycling DOF factor 2